Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd50 Peptide - C-terminal region

Ankrd50 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1311665

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankrd50 Rabbit Polyclonal Antibody (orb583544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178535

Preservative

Lyophilized powder

AA Sequence

LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perforin Rabbit Polyclonal Antibody
ER1803-77 100 µL

Perforin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CellBrite® Blue Cytoplasmic Membrane-Labeling Kit
#30024 1 Kit

CellBrite® Blue Cytoplasmic Membrane-Labeling Kit

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF647 conjugate, 0.1mg/mL
BNC473811-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn1r148 Mouse Gene Knockout Kit (CRISPR)
KN518943 1 Kit

Vmn1r148 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV E2 mouse monoclonal antibody [Clone ID: 4A6C9]
AM06087SU-N 100 µL

SARS-CoV E2 mouse monoclonal antibody [Clone ID: 4A6C9]

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D2]
TA504880BM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D2]

Sign In for Pricing
View Details