Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd50 Peptide - C-terminal region

Ankrd50 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1311665

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankrd50 Rabbit Polyclonal Antibody (orb583544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178535

Preservative

Lyophilized powder

AA Sequence

LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS640453 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
EIF5B Rabbit Polyclonal Antibody
TA361385 100 µL

EIF5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Procion Red MX 8B (>80%)
TRC-P755290-1G 1 g

Procion Red MX 8B (>80%)

Sign In for Pricing
View Details
EIF4G1 Rabbit Polyclonal Antibody
AP08089PU-N 100 µL

EIF4G1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Amino-2-chloro-4-fluorobenzoic Acid
TRC-A595475-500MG 500 mg

5-Amino-2-chloro-4-fluorobenzoic Acid

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF488A conjugate, 0.1mg/mL
BNC882416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details