Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anks1 Peptide - C-terminal region

Anks1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Anks1a, MGC59413, mKIAA0229

UniProt

Q68FS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anks1 Rabbit Polyclonal Antibody (orb325968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_001004275

Preservative

Lyophilized powder

AA Sequence

NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar Protein 8 (NOL8) Antibody
abx114219 100 µL

Nucleolar Protein 8 (NOL8) Antibody

Sign In for Pricing
View Details
Recombinant human PSGL-1/CD162 protein
ATGP3999-500 500 µg

Recombinant human PSGL-1/CD162 protein

Sign In for Pricing
View Details
VPS37A siRNA (Human)
orb1853061-01 15 nmol

VPS37A siRNA (Human)

Sign In for Pricing
View Details
VPS37A siRNA (Human)
orb1853061-02 30 nmol

VPS37A siRNA (Human)

Sign In for Pricing
View Details
7β-Fulvestrant
012661 1 mg

7β-Fulvestrant

Sign In for Pricing
View Details
Lysophospholipase I (LYPLA1) Antibody (FITC)
abx106545-01 20 µg

Lysophospholipase I (LYPLA1) Antibody (FITC)

Sign In for Pricing
View Details