Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anks1 Peptide - C-terminal region

Anks1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Anks1a, MGC59413, mKIAA0229

UniProt

Q68FS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anks1 Rabbit Polyclonal Antibody (orb325968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_001004275

Preservative

Lyophilized powder

AA Sequence

NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79B Rabbit PolymAb®
A22465 20 µL

CD79B Rabbit PolymAb®

Sign In for Pricing
View Details
CYP3A11 siRNA (Mouse)
CRM0950-01 15 nmol

CYP3A11 siRNA (Mouse)

Sign In for Pricing
View Details
CYP3A11 siRNA (Mouse)
CRM0950-02 30 nmol

CYP3A11 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Factor VIII Antibody (610) [DyLight 594]
NBP2-90256DL594 0.1 mL

Rabbit Monoclonal Factor VIII Antibody (610) [DyLight 594]

Sign In for Pricing
View Details
NBR1 Rabbit Polyclonal Antibody
BT-AP11720-01 20 µL

NBR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NBR1 Rabbit Polyclonal Antibody
BT-AP11720-02 50 µL

NBR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details