Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ano6 Peptide - middle region

Ano6 Peptide - middle region

Product Specifications

Product Name Alternative

2900059G15Rik, AA407480, AW554778, F730003B03Rik, Tmem16f

UniProt

Q6P9J9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ano6 Rabbit Polyclonal Antibody (orb579280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780553

Preservative

Lyophilized powder

AA Sequence

SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vcam1 qPCR Primer Pair
QM05786S 200 Tests

Mouse Vcam1 qPCR Primer Pair

Sign In for Pricing
View Details
Choline Acetyltransferase Recombinant Rabbit mAb
orb2326544-01 25 µL

Choline Acetyltransferase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Choline Acetyltransferase Recombinant Rabbit mAb
orb2326544-02 50 µL

Choline Acetyltransferase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Choline Acetyltransferase Recombinant Rabbit mAb
orb2326544-03 100 µL

Choline Acetyltransferase Recombinant Rabbit mAb

Sign In for Pricing
View Details
L-Citrulline Rabbit Polyclonal Antibody (BF594)
orb2557226 100 µL

L-Citrulline Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
S1RA (Sigma Receptor antagonist)
SD2393-5mg 5 mg

S1RA (Sigma Receptor antagonist)

Sign In for Pricing
View Details