Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANPEP Peptide - N-terminal region

ANPEP Peptide - N-terminal region

Product Specifications

Product Name Alternative

APN, CD13, GP150, LAP1, P150, PEPN

UniProt

P15144

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANPEP Rabbit Polyclonal Antibody (orb333733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001141

Preservative

Lyophilized powder

AA Sequence

VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPC2 Protein Lysate (Human) with C-Ha Tag
32046031 100 µg

NPC2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PTEN, Phosphorylated (S380) (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (PE)
MBS6433898-01 0.1 mL

PTEN, Phosphorylated (S380) (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (PE)

Sign In for Pricing
View Details
PTEN, Phosphorylated (S380) (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (PE)
MBS6433898-02 5x 0.1 mL

PTEN, Phosphorylated (S380) (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (PE)

Sign In for Pricing
View Details
C2cd4c (NM_001168624) Mouse Tagged Lenti ORF Clone
MR206656L4 10 µg

C2cd4c (NM_001168624) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ddo sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3647303 1.0 µg DNA

Ddo sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Kinesin Family Member 13B (KIF13B) Antibody (Biotin)
abx336257-01 20 µg

Kinesin Family Member 13B (KIF13B) Antibody (Biotin)

Sign In for Pricing
View Details