Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANPEP Peptide - N-terminal region

ANPEP Peptide - N-terminal region

Product Specifications

Product Name Alternative

APN, CD13, GP150, LAP1, P150, PEPN

UniProt

P15144

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANPEP Rabbit Polyclonal Antibody (orb333733) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001141

Preservative

Lyophilized powder

AA Sequence

VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dtymk shRNA (UAS) - Lentiviral mouse Dtymk shRNA (UAS, iRFP) (100)
GTR15254235 1 Vial

Lentiviral mouse Dtymk shRNA (UAS) - Lentiviral mouse Dtymk shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Non-sterile Hydrophilic PTFE Syringe Filters, 1.0 (μm), 4 (mm), 100pcs/pk
11024204 100 PCS

Non-sterile Hydrophilic PTFE Syringe Filters, 1.0 (μm), 4 (mm), 100pcs/pk

Sign In for Pricing
View Details
Human Intelectin-1/Omentin MAb (Clone 450520)
MAB4254-SP 25 µg

Human Intelectin-1/Omentin MAb (Clone 450520)

Sign In for Pricing
View Details
GPR31 Protein Vector (Rat) (pPM-C-HA)
22554026 500 ng

GPR31 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MPL 3'UTR Lenti-reporter-Luc Vector
30356081 1.0 µg

MPL 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
4-Chloro-6,7-dihydro-5h-pyrrolo[2,3-d]pyrimidine
OR903460-01 100 mg

4-Chloro-6,7-dihydro-5h-pyrrolo[2,3-d]pyrimidine

Sign In for Pricing
View Details