Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Antxr2 Peptide - N-terminal region

Antxr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310046B19Rik, AW561899, CMG-2, CMG2, cI-35

UniProt

Q6DFX2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Antxr2 Rabbit Polyclonal Antibody (orb581023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598499

Preservative

Lyophilized powder

AA Sequence

GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MSTO1 activation kit by CRISPRa
GA110559 1 Kit

Human MSTO1 activation kit by CRISPRa

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 1mg/mL
BNUM1985-50 1x 50 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 1mg/mL

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-2304
BSFT-2304 1 Unit

Floor Standing Shaking Incubator BSFT-2304

Sign In for Pricing
View Details
Recombinant Mouse Pcsk9 Protein (His Tag)
PDMM100245-01 20 µg

Recombinant Mouse Pcsk9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Pcsk9 Protein (His Tag)
PDMM100245-02 100 µg

Recombinant Mouse Pcsk9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Pcsk9 Protein (His Tag)
PDMM100245-03 500 µg

Recombinant Mouse Pcsk9 Protein (His Tag)

Sign In for Pricing
View Details