Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Antxr2 Peptide - N-terminal region

Antxr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310046B19Rik, AW561899, CMG-2, CMG2, cI-35

UniProt

Q6DFX2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Antxr2 Rabbit Polyclonal Antibody (orb581023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598499

Preservative

Lyophilized powder

AA Sequence

GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL48 Human Gene Knockout Kit (CRISPR)
KN403039 1 Kit

MRPL48 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKN1 (NM_002741) Human Recombinant Protein
TP307788 20 µg

PKN1 (NM_002741) Human Recombinant Protein

Sign In for Pricing
View Details
DPPA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E1]
TA800032AM 100 µL

DPPA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E1]

Sign In for Pricing
View Details
FGFR3 Recombinant Rabbit Monoclonal Antibody [JM110-33]
ET1703-65 100 µL

FGFR3 Recombinant Rabbit Monoclonal Antibody [JM110-33]

Sign In for Pricing
View Details
Alpk1 Rabbit Polyclonal Antibody
TA363341 100 µL

Alpk1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIF1 beta (ARNT) Human Knockdown Lysate
LY300054 100 µg

HIF1 beta (ARNT) Human Knockdown Lysate

Sign In for Pricing
View Details