Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa11 Peptide - C-terminal region

Anxa11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830099O17Rik, Anx11

UniProt

Q921F1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anxa11 Rabbit Polyclonal Antibody (orb576021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038497

Preservative

Lyophilized powder

AA Sequence

TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leonurine Hydrochloride
TRC-L329600-5G 5 g

Leonurine Hydrochloride

Sign In for Pricing
View Details
HLA DMB (HLA-DMB) (Center) Rabbit Polyclonal Antibody
AP52052PU-N 400 µL

HLA DMB (HLA-DMB) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cbx8 Recombinant Rabbit Monoclonal Antibody [PSH06-61]
HA722734 100 µL

Cbx8 Recombinant Rabbit Monoclonal Antibody [PSH06-61]

Sign In for Pricing
View Details
NCR2 Mouse Monoclonal Antibody [Clone ID: AT1G6]
AM50346PU-N 100 µL

NCR2 Mouse Monoclonal Antibody [Clone ID: AT1G6]

Sign In for Pricing
View Details
CD24 Mouse Monoclonal Antibody [Clone ID: SN3]
AM03032RP-N 100 Tests

CD24 Mouse Monoclonal Antibody [Clone ID: SN3]

Sign In for Pricing
View Details
ENAH Antibody
KC-1760-01 50 μL

ENAH Antibody

Sign In for Pricing
View Details