Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa11 Peptide - C-terminal region

Anxa11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830099O17Rik, Anx11

UniProt

Q921F1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anxa11 Rabbit Polyclonal Antibody (orb576021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038497

Preservative

Lyophilized powder

AA Sequence

TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 790 goat anti-mouse IgG (H+L) *Cross Adsorbed*
16790-AAT 1 mg

IFluor® 790 goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-MSEL-M0075-01 24 Tests

Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-MSEL-M0075-02 48 Tests

Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-MSEL-M0075-03 96 Tests

Mini Sample Mouse CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS708762 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Polystyrene C4 PHB
HB12516013.25G 25 g

Polystyrene C4 PHB

Sign In for Pricing
View Details