Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Peptide - middle region

Anxa13 Peptide - middle region

Product Specifications

Product Name Alternative

1810034H17Rik, AV055219

UniProt

Q99JG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anxa13 Rabbit Polyclonal Antibody (orb578625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081487

Preservative

Lyophilized powder

AA Sequence

KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrnp35 (NM_029532) Mouse Tagged ORF Clone
MR203027 10 µg

Snrnp35 (NM_029532) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Smad1 Antibody
MBS9503904-01 0.05 mL

Smad1 Antibody

Sign In for Pricing
View Details
Smad1 Antibody
MBS9503904-02 0.1 mL

Smad1 Antibody

Sign In for Pricing
View Details
Smad1 Antibody
MBS9503904-03 5x 0.1 mL

Smad1 Antibody

Sign In for Pricing
View Details
SHPRH Mouse Monoclonal Antibody [Clone ID: LBI3F8]
AMM10036VCF 100 µg

SHPRH Mouse Monoclonal Antibody [Clone ID: LBI3F8]

Sign In for Pricing
View Details
WDR83 Antibody - C-terminal region : HRP (ARP60384_P050-HRP)
ARP60384_P050-HRP 100 µL

WDR83 Antibody - C-terminal region : HRP (ARP60384_P050-HRP)

Sign In for Pricing
View Details