Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Peptide - middle region

Anxa13 Peptide - middle region

Product Specifications

Product Name Alternative

1810034H17Rik, AV055219

UniProt

Q99JG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anxa13 Rabbit Polyclonal Antibody (orb578625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081487

Preservative

Lyophilized powder

AA Sequence

KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transference Decoloring Shaker
E0018 1 Unit

Transference Decoloring Shaker

Sign In for Pricing
View Details
Boc-His(1-Mts)-OH · DCHA
A-2510.0001 1.0g

Boc-His(1-Mts)-OH · DCHA

Sign In for Pricing
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (C31.12) [mFluor Violet 610 SE]
NBP2-54396MFV610 0.1 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (C31.12) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae APS2 Protein (aa 1-147) [His]
VAng-Wyb4208-1mg 1 mg

Recombinant Saccharomyces Cerevisiae APS2 Protein (aa 1-147) [His]

Sign In for Pricing
View Details
Mouse Tagln3 Pre-designed siRNA Set B
SI114237B 1 Each

Mouse Tagln3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-African malaria mosquito LRIM1 Antibody, Cy3 Conjugate
DZ41079-Cy3 200 µL/Vial

Anti-African malaria mosquito LRIM1 Antibody, Cy3 Conjugate

Sign In for Pricing
View Details