Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1M2 Peptide - N-terminal region

AP1M2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSMU1B, MU-1B, MU1B, mu2, AP1-mu2

UniProt

Q9Y6Q5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP1M2 Rabbit Polyclonal Antibody (orb581563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005489

Preservative

Lyophilized powder

AA Sequence

MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NMNAT1 AssayLite™ Antibody (FITC Conjugate)
33001-05141 2x 75 µg

Human NMNAT1 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Human RGPD6 siRNA
abx931383-01 15 nmol

Human RGPD6 siRNA

Sign In for Pricing
View Details
Human RGPD6 siRNA
abx931383-02 30 nmol

Human RGPD6 siRNA

Sign In for Pricing
View Details
Rabbit anti-Drosophila yakuba (Fruit fly) TOTB Polyclonal Antibody
MBS7170572 Inquire

Rabbit anti-Drosophila yakuba (Fruit fly) TOTB Polyclonal Antibody

Sign In for Pricing
View Details
CALCR Protein Vector (Mouse) (pPM-C-His)
PV161089 500 ng

CALCR Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MAP4K5 Antibody - C-terminal region : FITC (ARP33102_P050-FITC)
ARP33102_P050-FITC 100 µL

MAP4K5 Antibody - C-terminal region : FITC (ARP33102_P050-FITC)

Sign In for Pricing
View Details