Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1M2 Peptide - N-terminal region

AP1M2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSMU1B, MU-1B, MU1B, mu2, AP1-mu2

UniProt

Q9Y6Q5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP1M2 Rabbit Polyclonal Antibody (orb581563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005489

Preservative

Lyophilized powder

AA Sequence

MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EPO-Alpha protein
CD01851 500 IU

Recombinant Human EPO-Alpha protein

Sign In for Pricing
View Details
KDEL Antibody (ATTO 680)
abx448703 100 µg

KDEL Antibody (ATTO 680)

Sign In for Pricing
View Details
Rabbit Anti-PGGT1A antibody
SL9547R-01 50 µL

Rabbit Anti-PGGT1A antibody

Sign In for Pricing
View Details
Rabbit Anti-PGGT1A antibody
SL9547R-02 100 µL

Rabbit Anti-PGGT1A antibody

Sign In for Pricing
View Details
Terpin Hydrate
TRC-T117513-100MG 100 mg

Terpin Hydrate

Sign In for Pricing
View Details
MAP2K3 (Phospho-Thr222) Polyclonal Conjugated Antibody
orb1630806 100 µL

MAP2K3 (Phospho-Thr222) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details