Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap3b1 Peptide - N-terminal region

Ap3b1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ap3b1

UniProt

D4AA25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap3b1 Rabbit Polyclonal Antibody (orb574772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM10075

Preservative

Lyophilized powder

AA Sequence

MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RDH8 Rabbit Polyclonal Antibody
TA361475 100 µL

RDH8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp219 (ZNF219) (N-term) Rabbit Polyclonal Antibody
AP11835PU-N 400 µL

Zfp219 (ZNF219) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccnj Mouse Gene Knockout Kit (CRISPR)
KN502820 1 Kit

Ccnj Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Melarsomine Dihydrochloride
TRC-M215105-5MG 5 mg

Melarsomine Dihydrochloride

Sign In for Pricing
View Details
Propargyl Benzyl Ether
TRC-P762560-5G 5 g

Propargyl Benzyl Ether

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (C-term) Rabbit Polyclonal Antibody
AP14958PU-N 400 µL

PI 4 Kinase type 2 beta (PI4K2B) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details