Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap3b1 Peptide - N-terminal region

Ap3b1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ap3b1

UniProt

D4AA25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap3b1 Rabbit Polyclonal Antibody (orb574772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM10075

Preservative

Lyophilized powder

AA Sequence

MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Munc 13 4 (UNC13D) Human qPCR Primer Pair (NM_199242)
HP219486 200 Reactions

Munc 13 4 (UNC13D) Human qPCR Primer Pair (NM_199242)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Cytomegalovirus,  10nm
GM-604-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Cytomegalovirus, 10nm

Sign In for Pricing
View Details
LCOR Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF808021 100 µg

LCOR Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details
4-Benzyloxybenzoic Acid
TRC-B287825-5G 5 g

4-Benzyloxybenzoic Acid

Sign In for Pricing
View Details
Adam11 Mouse Gene Knockout Kit (CRISPR)
KN500815 1 Kit

Adam11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclo(-Gly-Tyr)
TRC-C987420-250MG 250 mg

Cyclo(-Gly-Tyr)

Sign In for Pricing
View Details