Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3S1 Peptide - C-terminal region

AP3S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLAPS3, Sigma3A

UniProt

Q92572

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3S1 Rabbit Polyclonal Antibody (orb581504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001275

Preservative

Lyophilized powder

AA Sequence

IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVA Conjugated Rat Afamin (AFM)
RPU50881-01 50 µg

OVA Conjugated Rat Afamin (AFM)

Sign In for Pricing
View Details
OVA Conjugated Rat Afamin (AFM)
RPU50881-02 100 µg

OVA Conjugated Rat Afamin (AFM)

Sign In for Pricing
View Details
OVA Conjugated Rat Afamin (AFM)
RPU50881-03 1 mg

OVA Conjugated Rat Afamin (AFM)

Sign In for Pricing
View Details
Anti-IGF1R/CD221 Antibody (Lonigutamab-MMAE)
F2008-.1 100 µg

Anti-IGF1R/CD221 Antibody (Lonigutamab-MMAE)

Sign In for Pricing
View Details
5,10,15,20-Tetrakis (p-tolyl) porphyrin
TYD-00859-01 10 g

5,10,15,20-Tetrakis (p-tolyl) porphyrin

Sign In for Pricing
View Details
5,10,15,20-Tetrakis (p-tolyl) porphyrin
TYD-00859-02 5 g

5,10,15,20-Tetrakis (p-tolyl) porphyrin

Sign In for Pricing
View Details