Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1 Peptide - N-terminal region

Apbb1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fe65, Rir

UniProt

Q9QXJ1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb1 Rabbit Polyclonal Antibody (orb582773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033815

Preservative

Lyophilized powder

AA Sequence

DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP3 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
TA501305 100 µL

MPP3 Mouse Monoclonal Antibody [Clone ID: OTI5C2]

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, Amber, with EPDM ring Cap, DNase/RNase free 1000 un. - ABDOS
P10224A 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, Amber, with EPDM ring Cap, DNase/RNase free 1000 un. - ABDOS

Sign In for Pricing
View Details
Human ACADL shRNA Plasmid
abx950025-01 150 µg

Human ACADL shRNA Plasmid

Sign In for Pricing
View Details
Human ACADL shRNA Plasmid
abx950025-02 300 µg

Human ACADL shRNA Plasmid

Sign In for Pricing
View Details
Aminoallyl-dUTP-ATTO-Rho101
NU-803-RHO101 40 µL

Aminoallyl-dUTP-ATTO-Rho101

Sign In for Pricing
View Details
Nociceptin Rabbit Polyclonal Antibody (Cy3)
orb987645 100 µL

Nociceptin Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details