Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1 Peptide - N-terminal region

Apbb1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fe65, Rir

UniProt

Q9QXJ1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb1 Rabbit Polyclonal Antibody (orb582773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033815

Preservative

Lyophilized powder

AA Sequence

DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHES sodium salt
sc-293992 25 g

CHES sodium salt

Sign In for Pricing
View Details
Lithium acetate dihydrate pure
LC-10844.1 1 Kg

Lithium acetate dihydrate pure

Sign In for Pricing
View Details
CD7
MBS6467971-01 0.1 mL

CD7

Sign In for Pricing
View Details
CD7
MBS6467971-02 5x 0.1 mL

CD7

Sign In for Pricing
View Details
Rabbit Coiled Coil and C2 Domain Containing Protein 1A ELISA Kit
MBS093204 Inquire

Rabbit Coiled Coil and C2 Domain Containing Protein 1A ELISA Kit

Sign In for Pricing
View Details
Human Fumarylacetoacetase Recombinant Protein C-6 His Tag Lyophilized
MBS8432072-01 0.05 mg

Human Fumarylacetoacetase Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details