Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1ip Peptide - N-terminal region

Apbb1ip Peptide - N-terminal region

Product Specifications

Product Name Alternative

Apbb1ip

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb1ip Rabbit Polyclonal Antibody (orb583519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094047

Preservative

Lyophilized powder

AA Sequence

RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces Cerevisiae ORC6 Protein (aa 1-435) [His]
VAng-Wyb5214-1mg 1 mg

Recombinant Saccharomyces Cerevisiae ORC6 Protein (aa 1-435) [His]

Sign In for Pricing
View Details
Bile Esculin Azide Agar
DHBEA-0500 500 g

Bile Esculin Azide Agar

Sign In for Pricing
View Details
Mouse LETM1 domain-containing protein 1, Letmd1 ELISA KIT
ELI-39799m 96 Tests

Mouse LETM1 domain-containing protein 1, Letmd1 ELISA KIT

Sign In for Pricing
View Details
TRNAE35P Adenovirus (Human)
48002051 1.0 mL

TRNAE35P Adenovirus (Human)

Sign In for Pricing
View Details
WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 1 (WFIKKN1) Antibody (FITC)
abx348304-01 50 µL

WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 1 (WFIKKN1) Antibody (FITC)

Sign In for Pricing
View Details
WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 1 (WFIKKN1) Antibody (FITC)
abx348304-02 100 µL

WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 1 (WFIKKN1) Antibody (FITC)

Sign In for Pricing
View Details