Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1ip Peptide - N-terminal region

Apbb1ip Peptide - N-terminal region

Product Specifications

Product Name Alternative

Apbb1ip

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb1ip Rabbit Polyclonal Antibody (orb583519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094047

Preservative

Lyophilized powder

AA Sequence

RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEnCMV-Synj1-3×FLAG-SV40-Neo Plasmid
PVT37602 2 µg

pEnCMV-Synj1-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
GPIHBP1 Protein Vector (Rat) (pPM-C-HA)
PV270992 500 ng

GPIHBP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Tdpoz1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4044705 3x 1.0 µg

Tdpoz1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
60ml, VOC/EPA27.50x1.20x1 40.00FLX CLR SRW
EVO60C52400S000 72 Pieces

60ml, VOC/EPA27.50x1.20x1 40.00FLX CLR SRW

Sign In for Pricing
View Details
Thioredoxin Reductase 2 discontinued
298963 100 µL

Thioredoxin Reductase 2 discontinued

Sign In for Pricing
View Details
Glutathione S Transferase Kappa 1 (GSTK1) Antibody
abx322081-01 20 µL

Glutathione S Transferase Kappa 1 (GSTK1) Antibody

Sign In for Pricing
View Details