Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb2 Peptide - N-terminal region

Apbb2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1562438

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb2 Rabbit Polyclonal Antibody (orb582824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_223399

Preservative

Lyophilized powder

AA Sequence

GQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ERG Antibody (ERG/9122R) [mFluor Violet 500 SE]
NBP3-26929MFV500 0.1 mL

Rabbit Monoclonal ERG Antibody (ERG/9122R) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
RCOR2 Recombinant Protein Antigen
NBP1-92323PEP 0.1 mL

RCOR2 Recombinant Protein Antigen

Sign In for Pricing
View Details
ATP7A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
12810065 1.0 µg DNA

ATP7A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cuzd1 sgRNA CRISPR Lentivector set (Rat)
K6973901 3x 1.0 µg

Cuzd1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Phaseolus vulgaris (PHA-L) (Texas Red)
518663 2 mg

Phaseolus vulgaris (PHA-L) (Texas Red)

Sign In for Pricing
View Details
PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)
MBS6332974-01 0.1 mL

PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405)

Sign In for Pricing
View Details