Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb2 Peptide - N-terminal region

Apbb2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1562438

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apbb2 Rabbit Polyclonal Antibody (orb582824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_223399

Preservative

Lyophilized powder

AA Sequence

GQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-08863 0.1 mg

Cyclin A1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
LAP2 Double Nickase Plasmid (h2)
sc-403613-NIC-2 20 µg

LAP2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
HHAT CRISPR All-in-one AAV vector set (with saCas9)(Human)
23238151 3x 1.0 µg DNA

HHAT CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human SOCS2 knockout cell line
ABC-KH14406 1 Vial

Human SOCS2 knockout cell line

Sign In for Pricing
View Details
C14orf93 Recombinant Protein (Human)
RP003784 100 µg

C14orf93 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lcn5 Protein Vector (Mouse) (pPM-C-His)
PV196109 500 ng

Lcn5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details