Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB3 Peptide - N-terminal region

APBB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FE65L2, MGC150555, MGC87674, SRA

UniProt

O95704

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APBB3 Rabbit Polyclonal Antibody (orb581747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573420

Preservative

Lyophilized powder

AA Sequence

SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMIZ2 Adenovirus (Rat)
51272056 1.0 mL

ZMIZ2 Adenovirus (Rat)

Sign In for Pricing
View Details
Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit
MBS7205789-01 48 Well

Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit
MBS7205789-02 96 Well

Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit
MBS7205789-03 5x 96 Well

Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit
MBS7205789-04 10x 96 Well

Guinea pig Centromere/kinetochore protein zw10 homolog (ZW10) ELISA Kit

Sign In for Pricing
View Details
TRIM55 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2467807 1.0 µg DNA

TRIM55 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details