Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apoa1 Peptide - N-terminal region

Apoa1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ApoA-I

UniProt

P04639

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apoa1 Rabbit Polyclonal Antibody (orb582266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036870

Preservative

Lyophilized powder

AA Sequence

LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD7507
BA8852-10 10 mg

AZD7507

Sign In for Pricing
View Details
FOXN1 Rabbit Polyclonal Antibody
orb556213 100 µL

FOXN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human DHX29 sgRNA gene knockout kit - Lentiviral human DHX29 sgRNA gene knockout kit (25)
GTR15359262 1 Vial

Lentiviral human DHX29 sgRNA gene knockout kit - Lentiviral human DHX29 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SASS6 Protein Vector (Rat) (pPB-C-His)
PV303330 500 ng

SASS6 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Salmonella typhimurium (strain LT2/SGSC1412/700720) YBEY Polyclonal Antibody
MBS7182954 Inquire

Rabbit anti-Salmonella typhimurium (strain LT2/SGSC1412/700720) YBEY Polyclonal Antibody

Sign In for Pricing
View Details
ENPP7 Rabbit pAb
E45R25016N 50 ul

ENPP7 Rabbit pAb

Sign In for Pricing
View Details