Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apoa1 Peptide - N-terminal region

Apoa1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ApoA-I

UniProt

P04639

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Apoa1 Rabbit Polyclonal Antibody (orb582266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036870

Preservative

Lyophilized powder

AA Sequence

LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reagecon 2 mg/L C as Sucrose Total Organic Carbon (TOC) Standard for Sievers 900/M9 Analysers
RTOCS03 40 mL

Reagecon 2 mg/L C as Sucrose Total Organic Carbon (TOC) Standard for Sievers 900/M9 Analysers

Sign In for Pricing
View Details
FMOD Protein Vector (Mouse) (pPM-C-His)
PV179841 500 ng

FMOD Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-FOXN4 Antibody
DL94209A-01 50 µL

Rabbit anti-FOXN4 Antibody

Sign In for Pricing
View Details
Rabbit anti-FOXN4 Antibody
DL94209A-02 100 µL

Rabbit anti-FOXN4 Antibody

Sign In for Pricing
View Details
GCSH Protein Vector (Rat) (pPB-C-His)
PV269874 500 ng

GCSH Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Canine anti neutrophil antibody, ANA ELISA kit
GTR10466758 96 Well

Canine anti neutrophil antibody, ANA ELISA kit

Sign In for Pricing
View Details