Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA2 Peptide - N-terminal region

APOA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ApoAII, Apo-AII, ApoA-II

UniProt

P02652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOA2 Rabbit Polyclonal Antibody (orb582397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001634

Preservative

Lyophilized powder

AA Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aqr activation kit by CRISPRa
GA200258 1 Kit

Mouse Aqr activation kit by CRISPRa

Sign In for Pricing
View Details
2-Amino-6-nitrobenzoic Acid
TRC-A618505-2.5G 2.5 g

2-Amino-6-nitrobenzoic Acid

Sign In for Pricing
View Details
Eurycomanone
TRC-E939010-5MG 5 mg

Eurycomanone

Sign In for Pricing
View Details
Diminazene-13C2,15N4 Dihydrochloride (major)
TRC-D479552-1MG 1 mg

Diminazene-13C2,15N4 Dihydrochloride (major)

Sign In for Pricing
View Details
LOC120082 Human qPCR Primer Pair (XM_061849)
HP220859 200 Reactions

LOC120082 Human qPCR Primer Pair (XM_061849)

Sign In for Pricing
View Details
MAPK11 Rabbit Polyclonal Antibody
AP14127PU-N 400 µL

MAPK11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details