Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA2 Peptide - N-terminal region

APOA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ApoAII, Apo-AII, ApoA-II

UniProt

P02652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOA2 Rabbit Polyclonal Antibody (orb582397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001634

Preservative

Lyophilized powder

AA Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 Antibody
OC-759-01 50 μL

GAD2 Antibody

Sign In for Pricing
View Details
GAD2 Antibody
OC-759-02 100 µL

GAD2 Antibody

Sign In for Pricing
View Details
GAD2 Antibody
OC-759-03 1 mL

GAD2 Antibody

Sign In for Pricing
View Details
Human HELB activation kit by CRISPRa
GA114241 1 Kit

Human HELB activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Acvrl1 activation kit by CRISPRa
GA200056 1 Kit

Mouse Acvrl1 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Fluoroephedrone Hydrochloride
TRC-F591575-5MG 5 mg

3-Fluoroephedrone Hydrochloride

Sign In for Pricing
View Details