Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC2 Peptide - middle region

APOBEC2 Peptide - middle region

Product Specifications

Product Name Alternative

ARCD1, ARP1

UniProt

Q9Y235

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC2 Rabbit Polyclonal Antibody (orb330142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006780

Preservative

Lyophilized powder

AA Sequence

CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YiaL Antibody
orb831895 2 mg

YiaL Antibody

Sign In for Pricing
View Details
Ubiquitin Mouse Monoclonal Antibody (BF594)
orb1587714 100 µL

Ubiquitin Mouse Monoclonal Antibody (BF594)

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M2, aa225-359 (Chrm2, CHRM-2, 7TM Receptor, FLJ43243, HM2, MGC120006, MGC120007) (MaxLight 550)
MBS6246013-01 0.1 mL

Muscarinic Acetylcholine Receptor M2, aa225-359 (Chrm2, CHRM-2, 7TM Receptor, FLJ43243, HM2, MGC120006, MGC120007) (MaxLight 550)

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M2, aa225-359 (Chrm2, CHRM-2, 7TM Receptor, FLJ43243, HM2, MGC120006, MGC120007) (MaxLight 550)
MBS6246013-02 5x 0.1 mL

Muscarinic Acetylcholine Receptor M2, aa225-359 (Chrm2, CHRM-2, 7TM Receptor, FLJ43243, HM2, MGC120006, MGC120007) (MaxLight 550)

Sign In for Pricing
View Details
Anti-TrpV1 Antibody FL490 Conjugate
75-254-FL490 200 µL

Anti-TrpV1 Antibody FL490 Conjugate

Sign In for Pricing
View Details
Recombinant Chicken Interferon Gamma (IFNG), N-GST
AP2C308-01 1 mg

Recombinant Chicken Interferon Gamma (IFNG), N-GST

Sign In for Pricing
View Details