Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC2 Peptide - middle region

APOBEC2 Peptide - middle region

Product Specifications

Product Name Alternative

ARCD1, ARP1

UniProt

Q9Y235

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC2 Rabbit Polyclonal Antibody (orb330142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006780

Preservative

Lyophilized powder

AA Sequence

CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCND3 Protein Vector (Human) (pPM-C-HA)
PV053647 500 ng

KCND3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Caprine Sialic Acid (SA) ELISA Kit-Competitive
EK2F364 96 Tests

Caprine Sialic Acid (SA) ELISA Kit-Competitive

Sign In for Pricing
View Details
FSD FluorTM 800 NHS ester
POSC1803_5 mg 5 mg

FSD FluorTM 800 NHS ester

Sign In for Pricing
View Details
Mouse Aggrecan (AGC) ELISA Kit
MBS2703878-01 24 Strip Well

Mouse Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details
Mouse Aggrecan (AGC) ELISA Kit
MBS2703878-02 48 Well

Mouse Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details
Mouse Aggrecan (AGC) ELISA Kit
MBS2703878-03 96 Well

Mouse Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details