Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL5 Peptide - C-terminal region

APOL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APOL-V, APOLV

UniProt

Q9BWW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL5 Rabbit Polyclonal Antibody (orb331003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085145

Preservative

Lyophilized powder

AA Sequence

QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD1 Rabbit Polyclonal Antibody
AP08071PU-S 50 µL

SMAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BBS12 Human qPCR Primer Pair (NM_152618)
HP217848 200 Reactions

BBS12 Human qPCR Primer Pair (NM_152618)

Sign In for Pricing
View Details
NRF1 (NRF1/2608), CF405S conjugate, 0.1mg/mL
BNC042608-500 1x 500 µL

NRF1 (NRF1/2608), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), 1mg/mL
BNUM1167-50 1x 50 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), 1mg/mL

Sign In for Pricing
View Details
DGCR8 Human Gene Knockout Kit (CRISPR)
KN219451LP 1 Kit

DGCR8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmed2 Mouse Gene Knockout Kit (CRISPR)
KN517679 1 Kit

Tmed2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details