Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL5 Peptide - C-terminal region

APOL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APOL-V, APOLV

UniProt

Q9BWW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL5 Rabbit Polyclonal Antibody (orb331003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085145

Preservative

Lyophilized powder

AA Sequence

QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF806188 100 µg

Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

Sign In for Pricing
View Details
Capsazepine
TRC-C175710-50MG 50 mg

Capsazepine

Sign In for Pricing
View Details
ReadiLink™ xtra Rapid iFluor® 350 Antibody Labeling Kit *BSA-Compatible*
1950-AAT 2 Labelings

ReadiLink™ xtra Rapid iFluor® 350 Antibody Labeling Kit *BSA-Compatible*

Sign In for Pricing
View Details
CPNE1 (NM_152926) Human Recombinant Protein
TP321253L 1 mg

CPNE1 (NM_152926) Human Recombinant Protein

Sign In for Pricing
View Details
Blm Mouse Gene Knockout Kit (CRISPR)
KN502177 1 Kit

Blm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS621319 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details