Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL5 Peptide - C-terminal region

APOL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APOL-V, APOLV

UniProt

Q9BWW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOL5 Rabbit Polyclonal Antibody (orb331004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085145

Preservative

Lyophilized powder

AA Sequence

PVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAPARKGRQAPGRHRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 Polyclonal Antibody APC Conjugated
orb1540525 100 µL

CD68 Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
AMN1 Antibody - N-terminal region : Biotin (ARP54560_P050-Biotin)
ARP54560_P050-Biotin 100 µL

AMN1 Antibody - N-terminal region : Biotin (ARP54560_P050-Biotin)

Sign In for Pricing
View Details
ZNF579 Rabbit pAb, Pacific Blue conjugated
orb2868493 100 µL

ZNF579 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
SEMA6A Antibody
orb524934-01 50 μL

SEMA6A Antibody

Sign In for Pricing
View Details
SEMA6A Antibody
orb524934-02 100 µL

SEMA6A Antibody

Sign In for Pricing
View Details
Beta-Amyloid (1-15)
CCP2000-01 1 mg

Beta-Amyloid (1-15)

Sign In for Pricing
View Details