Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

App Peptide - C-terminal region

App Peptide - C-terminal region

Product Specifications

Product Name Alternative

Abeta, Abpp, Adap, Ag, betaApp, Cvap, E030013M08Rik

UniProt

P12023

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with App Rabbit Polyclonal Antibody (orb584137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001185753

Preservative

Lyophilized powder

AA Sequence

LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mthfd1l Mouse Gene Knockout Kit (CRISPR)
KN510479 1 Kit

Mthfd1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC26A4 mouse monoclonal antibody, clone UIRF#01065, Azide Free
AM20191AF-N 100 µg

SLC26A4 mouse monoclonal antibody, clone UIRF#01065, Azide Free

Sign In for Pricing
View Details
Hars sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
23010116 3x 1.0 µg

Hars sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Anti-UFC1 Polyclonal Antibody
PAV4262 100 μL

Rabbit Anti-UFC1 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2D4, CT (UBE2D4, UBCH5D, Ubiquitin-conjugating enzyme E2 D4, HBUCE1, Ubiquitin carrier protein D4, Ubiquitin-protein ligase D4) (MaxLight 490)
MBS6360657-01 0.1 mL

UBE2D4, CT (UBE2D4, UBCH5D, Ubiquitin-conjugating enzyme E2 D4, HBUCE1, Ubiquitin carrier protein D4, Ubiquitin-protein ligase D4) (MaxLight 490)

Sign In for Pricing
View Details
UBE2D4, CT (UBE2D4, UBCH5D, Ubiquitin-conjugating enzyme E2 D4, HBUCE1, Ubiquitin carrier protein D4, Ubiquitin-protein ligase D4) (MaxLight 490)
MBS6360657-02 5x 0.1 mL

UBE2D4, CT (UBE2D4, UBCH5D, Ubiquitin-conjugating enzyme E2 D4, HBUCE1, Ubiquitin carrier protein D4, Ubiquitin-protein ligase D4) (MaxLight 490)

Sign In for Pricing
View Details