Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

App Peptide - C-terminal region

App Peptide - C-terminal region

Product Specifications

Product Name Alternative

Abeta, Abpp, Adap, Ag, betaApp, Cvap, E030013M08Rik

UniProt

P12023

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with App Rabbit Polyclonal Antibody (orb584137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001185753

Preservative

Lyophilized powder

AA Sequence

LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]
TA810243AM 100 µL

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
Pdzk1 Mouse shRNA Lentiviral Particle (Locus ID 59020)
TL503395V 500 µL Each

Pdzk1 Mouse shRNA Lentiviral Particle (Locus ID 59020)

Sign In for Pricing
View Details
RpsB Antibody
orb827606 2 mg

RpsB Antibody

Sign In for Pricing
View Details
UQCR11 antibody (FITC)
60R-1378 100 ug

UQCR11 antibody (FITC)

Sign In for Pricing
View Details
Yellowfever mosquito OBP10 Rabbit Polyclonal Antibody (HRP)
orb2572243 200 µL

Yellowfever mosquito OBP10 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Anti-glucoprotein 210,GP210 ELISA Kit
CN-02508M2 48T

Mouse Anti-glucoprotein 210,GP210 ELISA Kit

Sign In for Pricing
View Details