Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aqp2 Peptide - middle region

Aqp2 Peptide - middle region

Product Specifications

Product Name Alternative

AQP-CD, WCH-CD, cph, jpk

UniProt

P56402

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033829

Preservative

Lyophilized powder

AA Sequence

ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit
EH1364 96 Tests

Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit

Sign In for Pricing
View Details
RNF224, ID (RNF224, RING finger protein 224) (FITC)
MBS6342866-01 0.2 mL

RNF224, ID (RNF224, RING finger protein 224) (FITC)

Sign In for Pricing
View Details
RNF224, ID (RNF224, RING finger protein 224) (FITC)
MBS6342866-02 5x 0.2 mL

RNF224, ID (RNF224, RING finger protein 224) (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal Cadherin-4/R-Cadherin Antibody (OTI4F5) [PerCP]
NBP2-70384PCP 0.1 mL

Mouse Monoclonal Cadherin-4/R-Cadherin Antibody (OTI4F5) [PerCP]

Sign In for Pricing
View Details
IFT20 (NM_174887) Human Tagged Lenti ORF Clone
RC201337L3 10 µg

IFT20 (NM_174887) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
S1pr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4801905 3x 1.0 µg

S1pr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details