Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aqp2 Peptide - middle region

Aqp2 Peptide - middle region

Product Specifications

Product Name Alternative

AQP-CD, WCH-CD, cph, jpk

UniProt

P56402

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033829

Preservative

Lyophilized powder

AA Sequence

ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-CD45, Alexa Fluor 680 conjugated antibody
SL7210R-AF680 100 µL

Rabbit Anti-CD45, Alexa Fluor 680 conjugated antibody

Sign In for Pricing
View Details
RAB19 siRNA (Rat)
orb1827308-01 15 nmol

RAB19 siRNA (Rat)

Sign In for Pricing
View Details
RAB19 siRNA (Rat)
orb1827308-02 30 nmol

RAB19 siRNA (Rat)

Sign In for Pricing
View Details
Anti-Rab15 antibody
STJ140094 200 µg

Anti-Rab15 antibody

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi N utilization substance protein B homolog (nusB)
MBS1037986-01 0.02 mg (E-Coli)

Recombinant Geobacter lovleyi N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details
Recombinant Geobacter lovleyi N utilization substance protein B homolog (nusB)
MBS1037986-02 0.1 mg (E-Coli)

Recombinant Geobacter lovleyi N utilization substance protein B homolog (nusB)

Sign In for Pricing
View Details