Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arc Peptide - middle region

Arc Peptide - middle region

Product Specifications

Product Name Alternative

Arc3.1, C86064, arg3.1

UniProt

B5DF02

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arc Rabbit Polyclonal Antibody (orb575134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099748

Preservative

Lyophilized powder

AA Sequence

TIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease A8 ELISA Kit
MBS096830-01 48 Well

Human Ribonuclease A8 ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A8 ELISA Kit
MBS096830-02 96 Well

Human Ribonuclease A8 ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A8 ELISA Kit
MBS096830-03 5x 96 Well

Human Ribonuclease A8 ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A8 ELISA Kit
MBS096830-04 10x 96 Well

Human Ribonuclease A8 ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-663b miRNA Agomir
CMJ0743-01 5 nmol

Hsa-miR-663b miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-663b miRNA Agomir
CMJ0743-02 10 nmol

Hsa-miR-663b miRNA Agomir

Sign In for Pricing
View Details