Arc Peptide - middle region
Arc Peptide - middle region
Product Specifications
Product Name Alternative
Arc3.1, C86064, arg3.1
UniProt
B5DF02
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Arc Rabbit Polyclonal Antibody (orb575134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099748
Preservative
Lyophilized powder
AA Sequence
TIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS064066-100ug 100 µg
MMP27 (NM_022122) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS9713844-01 48 Tests
Human Trinucleotide Repeat-Containing Gene 6B Protein (TNRC6B) ELISA Kit
Sign In for Pricing
View Details MBS9713844-02 96 Tests
Human Trinucleotide Repeat-Containing Gene 6B Protein (TNRC6B) ELISA Kit
Sign In for Pricing
View Details MBS9713844-03 5x 96 Tests
Human Trinucleotide Repeat-Containing Gene 6B Protein (TNRC6B) ELISA Kit
Sign In for Pricing
View Details