Ard1b Peptide - middle region
Ard1b Peptide - middle region
Product Specifications
Product Name Alternative
Naa11, Ard1b
UniProt
Q4V8K3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ard1b Rabbit Polyclonal Antibody (orb325405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001019913
Preservative
Lyophilized powder
AA Sequence
SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb478078 100 µL
Chitinase 3 like protein 2 Rabbit Polyclonal Antibody (HRP)
Sign In for Pricing
View Details 
MBS6431516-01 0.1 mL
PIAS2 (Protein Inhibitor of Activated STAT2, DIP, MIZ, MIZ1, SIZ2, ARIP3, PIASX, ZMIZ4, PIASX-BETA, PIASX-ALPHA) (HRP)
Sign In for Pricing
View Details MBS6431516-02 5x 0.1 mL
PIAS2 (Protein Inhibitor of Activated STAT2, DIP, MIZ, MIZ1, SIZ2, ARIP3, PIASX, ZMIZ4, PIASX-BETA, PIASX-ALPHA) (HRP)
Sign In for Pricing
View Details 
MBS9901432-01 48 Well
Camel N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit
Sign In for Pricing
View Details MBS9901432-02 96 Well
Camel N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit
Sign In for Pricing
View Details