Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arf4 Peptide - N-terminal region

Arf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA407803

UniProt

P61750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arf4 Rabbit Polyclonal Antibody (orb582985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031505

Preservative

Lyophilized powder

AA Sequence

VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTNND1 activation kit by CRISPRa
GA101061 1 Kit

Human CTNND1 activation kit by CRISPRa

Sign In for Pricing
View Details
ICAM4 (169-182) Goat Polyclonal Antibody
AP32146PU-N 100 µg

ICAM4 (169-182) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF568 conjugate, 0.1mg/mL
BNC681826-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N,N-Bis(2-hydroxyethyl) Tridecylamine
TRC-B443865-250MG 250 mg

N,N-Bis(2-hydroxyethyl) Tridecylamine

Sign In for Pricing
View Details
Uncoated Human CD5L (CD5 Antigen-like) ELISA Kit
E-UNEL-H0245-01 5x 96 Tests

Uncoated Human CD5L (CD5 Antigen-like) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CD5L (CD5 Antigen-like) ELISA Kit
E-UNEL-H0245-02 15x 96 Tests

Uncoated Human CD5L (CD5 Antigen-like) ELISA Kit

Sign In for Pricing
View Details