Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arf4 Peptide - N-terminal region

Arf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AA407803

UniProt

P61750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arf4 Rabbit Polyclonal Antibody (orb582985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031505

Preservative

Lyophilized powder

AA Sequence

VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), 0.2mg/mL
BNUB1857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), 0.2mg/mL

Sign In for Pricing
View Details
Shcbp1 Mouse Gene Knockout Kit (CRISPR)
KN515743 1 Kit

Shcbp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Munc 13 4 (UNC13D) activation kit by CRISPRa
GA116390 1 Kit

Human Munc 13 4 (UNC13D) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Desethyl Acetildenafil
TRC-D288820-2.5MG 2.5 mg

N-Desethyl Acetildenafil

Sign In for Pricing
View Details
LINC00851 (NM_001004344) Human Over-expression Lysate
LY423738 100 µg

LINC00851 (NM_001004344) Human Over-expression Lysate

Sign In for Pricing
View Details
STAT3 Recombinant Rabbit monoclonal Antibody
HA750087 100 µL

STAT3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details