Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP1 Peptide - middle region

ARFGAP1 Peptide - middle region

Product Specifications

Product Name Alternative

ARF1GAP, HRIHFB2281, MGC39924

UniProt

Q8N6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFGAP1 Rabbit Polyclonal Antibody (orb583464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060679

Preservative

Lyophilized powder

AA Sequence

WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-amino-5-fluoronicotinate
PC251385-01 100 mg

Ethyl 2-amino-5-fluoronicotinate

Sign In for Pricing
View Details
Ethyl 2-amino-5-fluoronicotinate
PC251385-02 250 mg

Ethyl 2-amino-5-fluoronicotinate

Sign In for Pricing
View Details
PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS)
MBS646252-01 0.05 mg

PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS)

Sign In for Pricing
View Details
PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS)
MBS646252-02 5x 0.05 mg

PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS)

Sign In for Pricing
View Details
Myc-tag Antibody
E38PA9004 100 µL

Myc-tag Antibody

Sign In for Pricing
View Details
Olr1064 (NM_001001076) Rat Untagged Clone
RN212573 10 µg

Olr1064 (NM_001001076) Rat Untagged Clone

Sign In for Pricing
View Details