Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP3 Peptide - C-terminal region

ARFGAP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARFGAP1, FLJ45618

UniProt

Q9NP61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFGAP3 Rabbit Polyclonal Antibody (orb331154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055385

Preservative

Lyophilized powder

AA Sequence

SYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 405)
MBS6193355-01 0.1 mL

USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 405)

Sign In for Pricing
View Details
USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 405)
MBS6193355-02 5x 0.1 mL

USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 405)

Sign In for Pricing
View Details
ABCC9 discontinued
385167 200 µL

ABCC9 discontinued

Sign In for Pricing
View Details
Major centromere autoantigen B
orb1643008-01 50 µg

Major centromere autoantigen B

Sign In for Pricing
View Details
Major centromere autoantigen B
orb1643008-02 100 µg

Major centromere autoantigen B

Sign In for Pricing
View Details
Major centromere autoantigen B
orb1643008-03 1 mg

Major centromere autoantigen B

Sign In for Pricing
View Details