Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP3 Peptide - C-terminal region

ARFGAP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARFGAP1, FLJ45618

UniProt

Q9NP61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFGAP3 Rabbit Polyclonal Antibody (orb331154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055385

Preservative

Lyophilized powder

AA Sequence

SYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VRL1 (TRPV2) (595-764) Rabbit Polyclonal Antibody
AP23163PU-N 50 µL

VRL1 (TRPV2) (595-764) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDMX, phosphorylated (Ser367) discontinued
538845-01 30ul

MDMX, phosphorylated (Ser367) discontinued

Sign In for Pricing
View Details
MDMX, phosphorylated (Ser367) discontinued
538845-02 100 µL

MDMX, phosphorylated (Ser367) discontinued

Sign In for Pricing
View Details
RET  Protein Vector (Rat) (pPB-C-His)
PV298814 500 ng

RET Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CLIA kit for Human GUCA2B (Guanylate Cyclase Activator 2B)
E-CL-H0331 96 Tests

CLIA kit for Human GUCA2B (Guanylate Cyclase Activator 2B)

Sign In for Pricing
View Details
PDZK1P2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1625404 1.0 µg DNA

PDZK1P2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details