Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP1 Peptide - C-terminal region

ARFIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSU52521, MGC117369

UniProt

P53367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP1 Rabbit Polyclonal Antibody (orb582341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020766

Preservative

Lyophilized powder

AA Sequence

NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: LBI6D11]
AMM19941V 100 µL

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: LBI6D11]

Sign In for Pricing
View Details
H mgN2P46 (NM_001005268) Human Over-expression Lysate
E45H03452-2 20 µg

H mgN2P46 (NM_001005268) Human Over-expression Lysate

Sign In for Pricing
View Details
Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)
MBS2170235-01 0.1 mL

Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)

Sign In for Pricing
View Details
Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)
MBS2170235-02 0.2 mL

Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)

Sign In for Pricing
View Details
Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)
MBS2170235-03 0.5 mL

Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)

Sign In for Pricing
View Details
Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)
MBS2170235-04 1 mL

Polyclonal Antibody to Deiodinase, Iodothyronine, Type II (DIO2)

Sign In for Pricing
View Details