Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP1 Peptide - C-terminal region

ARFIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSU52521, MGC117369

UniProt

P53367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP1 Rabbit Polyclonal Antibody (orb582341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020766

Preservative

Lyophilized powder

AA Sequence

NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CGA/HCG Protein, Fc Tag
E40KMPH2429 20 µg

Human CGA/HCG Protein, Fc Tag

Sign In for Pricing
View Details
Campylobacter jejuni subsp wlaB/pglK Camelus Monoclonal Antibody
orb2958565-01 100 µg

Campylobacter jejuni subsp wlaB/pglK Camelus Monoclonal Antibody

Sign In for Pricing
View Details
Campylobacter jejuni subsp wlaB/pglK Camelus Monoclonal Antibody
orb2958565-02 1 mg

Campylobacter jejuni subsp wlaB/pglK Camelus Monoclonal Antibody

Sign In for Pricing
View Details
Psg17 shRNA (m) Lentiviral Particles
sc-152543-V 200 µL

Psg17 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
GPR177 Rabbit Polyclonal Antibody (Biotin)
orb2119240 100 µL

GPR177 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RAB24 antibody
E39-07007 100 µg -100 µL

RAB24 antibody

Sign In for Pricing
View Details