Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Peptide - N-terminal region

ARFIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb574517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036534

Preservative

Lyophilized powder

AA Sequence

PEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRM Polyclonal Antibody
E-AB-12853-01 20 µL

PTPRM Polyclonal Antibody

Sign In for Pricing
View Details
PTPRM Polyclonal Antibody
E-AB-12853-02 60 µL

PTPRM Polyclonal Antibody

Sign In for Pricing
View Details
PTPRM Polyclonal Antibody
E-AB-12853-03 120 µL

PTPRM Polyclonal Antibody

Sign In for Pricing
View Details
PTPRM Polyclonal Antibody
E-AB-12853-04 200 µL

PTPRM Polyclonal Antibody

Sign In for Pricing
View Details
PPM1K (NM_152542) Human Over-expression Lysate
LC403474 20 µg

PPM1K (NM_152542) Human Over-expression Lysate

Sign In for Pricing
View Details
LSG1 (NM_018385) Human Recombinant Protein
TP309779 20 µg

LSG1 (NM_018385) Human Recombinant Protein

Sign In for Pricing
View Details