Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Peptide - N-terminal region

ARFIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb574517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036534

Preservative

Lyophilized powder

AA Sequence

PEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF3 (NM_001128616) Human Over-expression Lysate
LC426978 20 µg

ARHGEF3 (NM_001128616) Human Over-expression Lysate

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF640R conjugate, 0.1mg/mL
BNC402428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPCR 2037 (GPR151) Mouse Monoclonal Antibody [Clone ID: OTI1D8]
CF811791 100 µg

GPCR 2037 (GPR151) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Octylamine
TRC-O270815-250G 250 g

Octylamine

Sign In for Pricing
View Details
5,6-Diaminobenzimidazole Dihydrochloride
TRC-D416201-25MG 25 mg

5,6-Diaminobenzimidazole Dihydrochloride

Sign In for Pricing
View Details
Human SH3PX1 (SNX9) activation kit by CRISPRa
GA109800 1 Kit

Human SH3PX1 (SNX9) activation kit by CRISPRa

Sign In for Pricing
View Details